{ "actions" : [ ] { }, return false; ] { }, "event" : "expandMessage", "action" : "rerender" } else { ] { ] "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", "event" : "deleteMessage", "event" : "MessagesWidgetAnswerForm", o.innerHTML = ""; LITHIUM.AjaxSupport.ComponentEvents.set({ ], } "actions" : [ } "action" : "rerender" "context" : "envParam:selectedMessage", beschwerde wurde von Aldi Talk nicht angenommen zu einem Supervisior konnte er mich auch nicht verbinden das ist abzoge…. Bist du sicher, dass du fortfahren möchtest? "event" : "removeThreadUserEmailSubscription", setWarning(pagerId); clearWarning(pagerId); ;(function($) { "actions" : [ { }, ] "event" : "markAsSpamWithoutRedirect", }); "context" : "", Ihr Guthaben hat eine unbegrenzte Gültigkeit, sofern Ihr Prepaid-Vertrag bei BILDmobil nicht beendet wurde. "event" : "unapproveMessage", { "buttonDialogCloseAlt" : "Schließen", }, "useCountToKudo" : "false", }, "actions" : [ ] "showCountOnly" : "false", "action" : "rerender" { { "actions" : [ { { } ] ] }, }, "event" : "deleteMessage", }, "includeRepliesModerationState" : "false", watching = false; LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1668309 .lia-rating-control-passive', '#form_3'); "event" : "addThreadUserEmailSubscription", "action" : "rerender" { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ { "event" : "ProductAnswer", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "event" : "AcceptSolutionAction", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_52","feedbackSelector":".InfoMessage"}); { "revokeMode" : "true", ] "disableLinks" : "false", "disableKudosForAnonUser" : "false", "linkDisabled" : "false" "actions" : [ "truncateBodyRetainsHtml" : "false", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1671935 .lia-rating-control-passive', '#form_8'); "context" : "", }, { "initiatorDataMatcher" : "data-lia-message-uid" { }, "initiatorBinding" : true, "entity" : "1671935", Eigentlich sollte durch die Aufladung das gesamte Guthaben freigegeben werden, manchmal geschieht dies nicht immer automatisch. ', 'ajax'); } "action" : "rerender" }, "event" : "AcceptSolutionAction", "action" : "rerender" "action" : "pulsate" "action" : "addClassName" { "context" : "envParam:quiltName", "context" : "envParam:quiltName,message,product,contextId,contextUrl", { { "includeRepliesModerationState" : "false", }); ;(function($) { { ] ] { "context" : "envParam:quiltName", { "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101001101" { { Execute whatever should happen when entering the right sequence { "event" : "removeMessageUserEmailSubscription", })(LITHIUM.jQuery); } { if ( Number(val) < 1 ) LITHIUM.Dialog({ ] "actions" : [ "kudosLinksDisabled" : "false", "actions" : [ { "event" : "AcceptSolutionAction", "disallowZeroCount" : "false", "eventActions" : [ } ', 'ajax'); } "actions" : [ }, "useTruncatedSubject" : "true", }, } "useSimpleView" : "false", LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "", "initiatorDataMatcher" : "data-lia-message-uid" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", { var o = document.getElementById("custom_board_pagination_warning" + pagerId); '; "action" : "rerender" "actions" : [ { "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ function doChecks(pagerId, val) { "context" : "", return false; "action" : "rerender" } "actions" : [ $(this).removeClass('active'); { }, "useCountToKudo" : "false", { } "useTruncatedSubject" : "true", "action" : "rerender" "useCountToKudo" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61457","ajaxErrorEventName":"LITHIUM:ajaxError","token":"vLTltDzkvLARWSikNNkmaBPSpKXIcXj5qavBT7vyEyo. "kudosLinksDisabled" : "false", "event" : "removeMessageUserEmailSubscription", "event" : "ProductAnswerComment", ] { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61457","ajaxErrorEventName":"LITHIUM:ajaxError","token":"NOFFbpM8ceJboArk4l3CL4cx02Dy8L4KbyiCqJ3itN0. "useCountToKudo" : "false", "event" : "removeMessageUserEmailSubscription", { if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") "showCountOnly" : "false", "event" : "MessagesWidgetAnswerForm", "action" : "rerender" "event" : "MessagesWidgetEditAction", "showCountOnly" : "false", { { ] count++; LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_2db3b7ab02b0ad","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); "actions" : [ "event" : "ProductMessageEdit", { "actions" : [ LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "event" : "addMessageUserEmailSubscription", }, })(LITHIUM.jQuery); { "event" : "expandMessage", "event" : "MessagesWidgetAnswerForm", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", { ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_2db3b7ab02b0ad","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/61457&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); return false; "event" : "MessagesWidgetEditAnswerForm", }, }, ] }, } ] { ] { "entity" : "1670043", }, }, { "action" : "rerender" "displayStyle" : "horizontal", "context" : "envParam:quiltName", "kudosLinksDisabled" : "false", }, }); "actions" : [ "context" : "envParam:quiltName,message", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); }, } LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); "useSimpleView" : "false", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1668159,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.StarRating('#any_0_9', true, 2, 'LITHIUM:starRating'); { "action" : "addClassName" ', 'ajax'); "action" : "rerender" }); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_51","feedbackSelector":".InfoMessage"}); "event" : "RevokeSolutionAction", ] { { }, "action" : "rerender" "action" : "rerender" "actions" : [ } "context" : "envParam:entity", "event" : "deleteMessage", { } }, "context" : "envParam:quiltName,expandedQuiltName", "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", "actions" : [ } { ] "event" : "QuickReply", "componentId" : "kudos.widget.button", "truncateBodyRetainsHtml" : "false", { { ] "context" : "lia-deleted-state", ] }, ] "context" : "", ] "actions" : [ ] { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "MessagesWidgetMessageEdit", "disallowZeroCount" : "false", "useSubjectIcons" : "true", } "action" : "rerender" setWarning(pagerId); }, LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" }); ] "useTruncatedSubject" : "true", ] "useSubjectIcons" : "true", { }, ] { { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { }, "context" : "", "actions" : [ LITHIUM.Dialog({ { }, setWarning(pagerId); }, "context" : "", "action" : "rerender" { ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } ] "kudosable" : "true", }, Bist du sicher, dass du fortfahren möchtest? "defaultAriaLabel" : "", "displayStyle" : "horizontal", "actions" : [ "actions" : [ { "kudosLinksDisabled" : "false", "context" : "", "eventActions" : [ $('#node-menu li.active').children('ul').show(); })(LITHIUM.jQuery); ] "disableLabelLinks" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "context" : "", }, "event" : "MessagesWidgetEditAction", }, { else { }); "actions" : [ $(document).ready(function(){ "actions" : [ { "context" : "envParam:entity", } }, "actions" : [ count++; "actions" : [ "event" : "unapproveMessage", { LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); "buttonDialogCloseAlt" : "Schließen", ] "selector" : "#kudosButtonV2_3", "action" : "rerender" "parameters" : { LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ { "context" : "", }, }, "context" : "", "eventActions" : [ "actions" : [ "context" : "", "action" : "rerender" }, clearWarning(pagerId); ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_2db3b7ab02b0ad_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/61457&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"});

Parkhotel Stuttgart Getränkekarte, Schatzkammer Burg Forchtenstein, Harzer Hexenkessel Blankenburg, Camping Gößl Bad Aussee, Black Friday 2020 Asos, Apps Auf Tolino Installieren, Gratis Museum Luzern, See In Bayern Kreuzworträtsel, Barniner See Angelkarte,